OuterStats is here to display any thing is needed for www.lancelots.nl. We seek and locate Lancelots.nl information for inquirer. We will show you Lancelots value, date of creation, location, hosted server, local language and estimated data - The estimated data is a special algorithm built by us to demonstrate www.lancelots.nl worth.

Lancelots - voor en door freelancers

Lancelots.nl was created on the unknown, domain is hosted in ip:, and owner of this ips: . Our algorithm estimates Lancelots.nl worth to be about $8,810 and estimates that it gets about 2,207 visits per day. Lancelots.nl is located in Netherlands. Lancelots.nl using Apache/2.2.22 (Debian) server and powered by unknown.

Created: unavailable

Expires: unavailable

Hosted in: Netherlands

Host IP:

ICANN Registrar: Stichting Internet Domeinregistratie NL

Domain Archive: lancelots.nl in the past

Alexa Rank: #453282

Google Page Rank: 0

Server DNS A:

Server DNS NS: ns02.is.nl ns01.is.nl ns03.is.nl

Server Name: unavailable

Server Type: Apache/2.2.22 (Debian)

Server Side Language: unavailable

lancelots.nl - Daily Traffic Rank Trend In The Past 4 Months

Keyword Count Density
Lancelots 6 3.47
Freelancers 5 2.89
Zoek 4 2.31
Bedrijfsvoering 3 1.73
Aan 3 1.73
Mdash 3 1.73
Marketing 2 1.16
Starten 2 1.16
Ontwikkelen 2 1.16
Vaardigheden 2 1.16
Opdrachten 2 1.16
Ontwikkel 2 1.16
Netwerken 2 1.16
Bij 2 1.16
Gmt 2 1.16
Dec 2 1.16
Tue 2 1.16
Zope 2 1.16
Netwerkervaren 1 0.58
Ondernemerschapkernvaardighedenkernkwaliteitenpersoonlijkheidstypensamenwerkenbouw 1 0.58
Inspireren 1 0.58
Header Key Header Value
Date Tue, 12 Dec 2017 17:10:29 GMT
Server Apache/2.2.22 (Debian)
Location http://www.lancelots.nl/
Vary Accept-Encoding
Content-Length 310
Content-Type text/html; charset=iso-8859-1

We believe that every website pwner is able to earn money from his website.

Our estimations point that your Website Worth is $8,810.14, Your Daily Visitors could be in the area of 2207 per day and your estimated Daily Revenues could be around $6.62.

Server Country Code: NL

Server Country Name: Netherlands

Server Latitude: 52.382400512695

Server Longitude: 4.8994998931885

Server location

loncelots.nl, ltncelots.nl, lanselots.nl, lanvelots.nl, lanwelots.nl, lancmlots.nl, lancvlots.nl, lancevots.nl, lancelois.nl, lancelows.nl, lancelota.nl, lancelotd.nl, lancelote.nl, lanceloti.nl, lancelotn.nl, lancelotr.nl, lancelotsmnl, lancelots.no, lancleots.nl, clancelots.nl, elancelots.nl, llancelots.nl, lgancelots.nl, lvancelots.nl, lasncelots.nl, lanrcelots.nl, lanccelots.nl, lancfelots.nl, lancselots.nl, lanctelots.nl, lanceilots.nl, lancelcots.nl, lanceldots.nl, lancelnots.nl, lanceluots.nl, lancelvots.nl, lancelotes.nl, lancelotls.nl, lancelotns.nl, lancelotos.nl, lancelotus.nl, lancelotst.nl, lancelotsx.nl, lancelots.anl, lancelots.fnl, lancelots.inl, lancelots.knl, lancelots.nvl, lancelots.nle, lancelots.nlr

Domain name: lancelots.nl
Status: active

KPN Internedservices
Wielingenstraat 8

Abuse Contact:


Domain nameservers:

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).